DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Cpr64Ac

DIOPT Version :9

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:144 Identity:61/144 - (42%)
Similarity:77/144 - (53%) Gaps:20/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILFAACIAVASAGIIPA----AAPLAA--VAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREG 65
            :|.|..|:.|:..|..|    |||:|.  ||..|.|||:|||::.|.|.|..:||||.|.||...
  Fly    51 LLAAPAISYAAPAISYAPKVLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVN 115

  Fly    66 DVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVAAAPAAVVAAPAPVVRAAVAAPV 130
            .||.|.|||.:.||..|.|.||||.:|||||||.::.:.|...|.||..|||...:.:..     
  Fly   116 GVVHGSYSLAEPDGTIRKVTYTADKVNGFNAVVEKKGVAAVAIAKPALAVAAVPAITKIG----- 175

  Fly   131 VRAAPLTTTYAAAP 144
                     ||:||
  Fly   176 ---------YASAP 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 26/51 (51%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.