DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Cpr30F

DIOPT Version :9

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster


Alignment Length:162 Identity:66/162 - (40%)
Similarity:84/162 - (51%) Gaps:31/162 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKFTILFAACIAVASAGIIP----AAAPLAAVAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETR 63
            |....||...:..|:|..:|    .||.:..:.:..|.:....|.:.|.|.|..:||.|:|.|:|
  Fly     2 FALVSLFILGVGAAAAIELPIYHSPAAIVKPLLKTVEVEAPAHYDFAYSVHDEHTGDIKSQTESR 66

  Fly    64 EGDVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVAAAPAAVVAAPAPVVRAAVAA 128
            :||.|||||:|.|||||.|.||||:|..|||||||||:||                       ..
  Fly    67 KGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVRRDPL-----------------------GQ 108

  Fly   129 PVVRAAPLTTTYAAAPAPLAYAA----APAPL 156
            .|::|||:....|.||.||||||    |||.|
  Fly   109 KVIKAAPIAKLLAPAPLPLAYAAPKLLAPAKL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 30/51 (59%)
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:395303 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453212
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.