DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Cpr31A

DIOPT Version :9

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster


Alignment Length:178 Identity:78/178 - (43%)
Similarity:104/178 - (58%) Gaps:21/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ACIAVASAGIIPAAAPLAAVAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLN 75
            |...|.:|.::...|...||.:..|.:..|:|.:.|.|.|:|:||.|:|||||:|..|.|.||:.
  Fly   104 AAAPVVAAPVVKTVAAAPAVLKQVELESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVL 168

  Fly    76 DADGYRRIVDYTADPINGFNAVVRREPLVAAVA-AAPAAVVAAPAPVVRAAVAAPV-VRAAPLTT 138
            ||||::|.|.||||.||||||||:|||:|||.| |||...|:|||||       || :.:||:  
  Fly   169 DADGFKRTVTYTADDINGFNAVVQREPVVAARAVAAPVVSVSAPAPV-------PVHISSAPV-- 224

  Fly   139 TYAAAPAPLAY----AAAPAPLAYAA--PAPVVKAAPLVAAGPAIVKT 180
              |:.|||:.|    ..||..:...|  ...||::.  ||..|.:..|
  Fly   225 --ASLPAPIYYPHQQVFAPQQIQQVAEQQGEVVESP--VAQQPELEPT 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 30/51 (59%)
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453210
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.