DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CG34461

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001097547.1 Gene:CG34461 / 5740547 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster


Alignment Length:137 Identity:58/137 - (42%)
Similarity:72/137 - (52%) Gaps:49/137 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREP 97
            ::|:|||||.::||.|||:|||:|.||||||.||||:.:.||..|||||||||..||||||.:  
  Fly    48 AYPKYSFNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHK-- 110

  Fly    98 LSSAAVVVKPQATAVVPKVQLKPLKKLPALKPLSQASAVVHRSFAPVVHHAPVTHVVHHAAP--A 160
                        ||        |.|                     ::.||||.    ||||  |
  Fly   111 ------------TA--------PSK---------------------IIAHAPVL----HAAPVLA 130

  Fly   161 HSFVSHH 167
            |:.:.||
  Fly   131 HAPLLHH 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 35/51 (69%)
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:278791 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.