DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CG34462

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster


Alignment Length:198 Identity:46/198 - (23%)
Similarity:78/198 - (39%) Gaps:40/198 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFVTLIGLAQAGPL-------------PAKSSGSEDTYDSHP-----QYSFNYDVQDPETGDVKS 53
            :.:|.:..|.:.||             |.|.......|..|.     .|||.|::.||:|.:.:.
  Fly    14 VLITKVYAALSNPLSSKIEVYNQPEVTPEKERAKVRNYFVHEPYGPNTYSFGYEINDPQTQNSQF 78

  Fly    54 QSESR--DGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKV 116
            :.|.|  :|. :.|.|.....||......|.|.:..|::|.::         :.|    |...||
  Fly    79 REEKRFVNGS-IQGSYGYARPDGRIEVTKYMAKEDGGYSAQIQ---------IFK----AGDEKV 129

  Fly   117 Q-LKPLKKLPALKPLSQASAVVHRSFAPVVH-HAPVTHVVHHAA----PAHSFVSHHVPVLKTTV 175
            : :.|.::...|...|::.|..:.::.|..| :..|:||..|.|    ..|....:|:.|.|..:
  Fly   130 KSVWPTERPDILVERSKSDAPSNITWDPKSHLNVTVSHVADHVAQQLKQQHGLDLNHIDVTKDVL 194

  Fly   176 HHA 178
            ..|
  Fly   195 KPA 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 16/53 (30%)
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.