DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CPR121

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_001688324.1 Gene:CPR121 / 5667573 VectorBaseID:AGAP003383 Length:193 Species:Anopheles gambiae


Alignment Length:129 Identity:60/129 - (46%)
Similarity:74/129 - (57%) Gaps:19/129 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AGPLP-AKSSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVD 80
            |.||. ||.:.....||::||||::|.|.|..|||.|:|.|||.||||.|.||:.:.||.||||:
Mosquito    70 AAPLAVAKVAAPYAEYDANPQYSYSYAVADAVTGDNKNQQESRSGDVVTGSYSLVEPDGTRRTVE 134

  Fly    81 YTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLKPLKKLPALKPLS-QASAVVHRSFAP 143
            |.||.:.||||||.||||:..||.               |:.|..|  ||: .|.|.|...:||
Mosquito   135 YNADPINGFNAVVHREPLAVKAVA---------------PIAKYAA--PLAYPAVAKVAAPYAP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 29/51 (57%)
CPR121XP_001688324.1 Chitin_bind_4 91..143 CDD:278791 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12236
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.