DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Lcp65Ab2

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster


Alignment Length:102 Identity:26/102 - (25%)
Similarity:47/102 - (46%) Gaps:9/102 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFVTLIGLAQAGPLPAKSSGSEDTYDSHPQ-YSFNYDVQD----PETGDVKSQSESRDGDVVHGQ 66
            :||.|..:|.|.|..|:.  .....|..|: :|.:.:..|    .:.|.:|:.....:..||||.
  Fly     6 VFVALFAMAVARPNLAEI--VRQVSDVEPEKWSSDVETSDGTSIKQEGVLKNAGTDNEAAVVHGS 68

  Fly    67 YS-VNDADGYRRTVDYTADDVRGFNAVVRREPLSSAA 102
            :: |::..|.:.|:.|.||: .|:.......|::..|
  Fly    69 FTWVDEKTGEKFTITYVADE-NGYQPQGAHLPVAPVA 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 14/56 (25%)
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:306811 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.