DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CPR94

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_001238123.1 Gene:CPR94 / 4578370 VectorBaseID:AGAP010114 Length:231 Species:Anopheles gambiae


Alignment Length:236 Identity:83/236 - (35%)
Similarity:103/236 - (43%) Gaps:63/236 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVKTALFVTLIGLAQAGPLPAKSSGSEDTYDSHPQ----------------------------- 36
            |..|..|..||:..|.||.||....||..|..|..|                             
Mosquito     1 MAFKFVLLATLVAAASAGLLPVAHHGSIATSHSSIQHHAAPAIHHVGSVHAAPAIYQHSAPAIVK 65

  Fly    37 ------------------YSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTA 83
                              |.|:|.|.|..|||:|||.|:|.||.||||||:.|:||::|.|||.|
Mosquito    66 TIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHA 130

  Fly    84 DDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLKPLKKLPALKPLSQ---ASAVVHRSFAPVV 145
            |...||||||||||  ||..:.:|....:...|.:......|......|   |:.:.|.| ||:.
Mosquito   131 DHHTGFNAVVRREP--SAVKIAQPVHKVIAQPVHVSSYAHAPVAHATVQHHHAAPIAHYS-APIA 192

  Fly   146 HH-APVTH----VVHHAAP-AHSFVSHHVPVLKTTVHHAHH 180
            || ||:.|    :.||||| |||..|    ::....|.:||
Mosquito   193 HHAAPIAHYAAPIAHHAAPIAHSTSS----IVHGPSHLSHH 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 30/51 (59%)
CPR94XP_001238123.1 Chitin_bind_4 84..136 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.