DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CPR5

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_001238481.1 Gene:CPR5 / 4577352 VectorBaseID:AGAP001668 Length:246 Species:Anopheles gambiae


Alignment Length:227 Identity:83/227 - (36%)
Similarity:113/227 - (49%) Gaps:48/227 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVKTALFVTLIGLAQAGPL--PAKS---------------------------SGSEDTYDSHPQ 36
            |..|...|..|:.:|:||.:  ||.|                           :...:.||::||
Mosquito     1 MAFKFLTFAALVAVARAGLIASPAVSYAAAPALVAAPVAKVAYAAAPIAKVAYAAQPEEYDANPQ 65

  Fly    37 YSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPLSSA 101
            |||:|.:.|..|||.|||.|||.||||.|.|||.|.||.:|||:||||...||||||.||||::.
Mosquito    66 YSFSYGISDALTGDSKSQQESRSGDVVQGSYSVVDPDGTKRTVEYTADPHNGFNAVVHREPLAAK 130

  Fly   102 AVV-VKPQATAVV--PKVQLKPLKKLPALKPLSQASAVVHRSFA--PVVHH-APVTH------VV 154
            .:| ..|.||.|:  |.|..    ..|..|.:|.|:.|..:::.  |.:.: ||:|.      .:
Mosquito   131 TIVAAAPVATKVIAQPAVAY----AAPVAKTISYAAPVATKTYVAQPALSYAAPLTKTYVSQPAL 191

  Fly   155 HHAAPAHSFVSHHVPVLKTTVHHAHHPHAISY 186
            .:|||....:|:..|:...|  :...| ||||
Mosquito   192 SYAAPVAKTISYSAPLATKT--YVSQP-AISY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 32/51 (63%)
CPR5XP_001238481.1 Chitin_bind_4 66..118 CDD:278791 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12236
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.