DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CPR56

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_001237151.1 Gene:CPR56 / 4576727 VectorBaseID:AGAP006833 Length:168 Species:Anopheles gambiae


Alignment Length:94 Identity:36/94 - (38%)
Similarity:47/94 - (50%) Gaps:15/94 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KSSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVR 87
            ||||        |.|.|.|.|:||.:||.|.|.|.|.||.|.|.|..:::||.:|.|:|.|...:
Mosquito    69 KSSG--------PSYEFGYGVKDPISGDHKDQWEKRQGDHVKGAYRFDESDGTQRIVEYEASGKK 125

  Fly    88 GFNAVVRREPLSSAAVVVKPQATAVVPKV 116
            ||.|.|:.       |..|.:.|...|.:
Mosquito   126 GFEATVKN-------VEKKVEGTEEDPSI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 23/51 (45%)
CPR56XP_001237151.1 Chitin_bind_4 75..127 CDD:278791 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.