DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Cpr100A

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_651829.1 Gene:Cpr100A / 43657 FlyBaseID:FBgn0039805 Length:241 Species:Drosophila melanogaster


Alignment Length:115 Identity:33/115 - (28%)
Similarity:43/115 - (37%) Gaps:27/115 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QDPETGDVKSQSESRDGD-----------------------VVHGQYSVNDADGYRRTVDYTADD 85
            |||:|..:.|:.....||                       ..||.||..|..|.|||:.|||..
  Fly    21 QDPKTAAIISEQRYLSGDGKFGAAYEQEDGINFKEETDADGTRHGSYSYLDPTGQRRTISYTAGK 85

  Fly    86 VRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLKPLK-KLPALKPLSQAS 134
             .||.|.....|.:..|...........|:.|.:|.: :.||.:|  |||
  Fly    86 -NGFQASGDHLPQAPPAPPQPVPTAGYQPQQQYQPQQYQAPAPQP--QAS 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 19/67 (28%)
Cpr100ANP_651829.1 Chitin_bind_4 44..88 CDD:278791 12/44 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.