Sequence 1: | NP_524247.1 | Gene: | Edg84A / 40818 | FlyBaseID: | FBgn0000552 | Length: | 188 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650905.2 | Gene: | Cpr92F / 42450 | FlyBaseID: | FBgn0038819 | Length: | 381 | Species: | Drosophila melanogaster |
Alignment Length: | 237 | Identity: | 60/237 - (25%) |
---|---|---|---|
Similarity: | 85/237 - (35%) | Gaps: | 84/237 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 VKTALFVTLIGLAQAGPLPAKSSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQY 67
Fly 68 SVNDADGYRRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLKPLKKLPALKPLSQ 132
Fly 133 ASAVVHRSFAPVVH---------------------HAPVTHVVHHAAPAHSFVSHH--------- 167
Fly 168 ----------------VPVLKTTV------HHAHHPHAISYV 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Edg84A | NP_524247.1 | Chitin_bind_4 | 37..89 | CDD:278791 | 18/51 (35%) |
Cpr92F | NP_650905.2 | Chitin_bind_4 | 37..84 | CDD:278791 | 18/49 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45453156 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR12236 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |