DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Cpr92F

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:237 Identity:60/237 - (25%)
Similarity:85/237 - (35%) Gaps:84/237 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VKTALFVTLIGLAQAGPLPAKSSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQY 67
            :..||.::.:..:..|.:    |......|.| .::::|...||.:  .|.::.|.|| ..||.|
  Fly     6 IAAALLISTVSASWHGAV----STQYQHLDPH-SHTYSYGYADPNS--QKHETRSHDG-TTHGSY 62

  Fly    68 SVNDADGYRRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLKPLKKLPALKPLSQ 132
            |..|..|:.::|.||||...|||||...          .|||    |:|...|:          .
  Fly    63 SYVDGHGHVQSVSYTADPHHGFNAVGTN----------LPQA----PQVHAAPV----------Y 103

  Fly   133 ASAVVHRSFAPVVH---------------------HAPVTHVVHHAAPAHSFVSHH--------- 167
            |:|..|.::||..|                     ||...|...|||.||:...||         
  Fly   104 AAAHAHGAYAPYAHGPIHIPVLTHGGVPVDTPEVQHAKAAHAAAHAAAAHNAGGHHLYKRSIYGG 168

  Fly   168 ----------------VPVLKTTV------HHAHHPHAISYV 187
                            |||....|      |:|.|..|:.:|
  Fly   169 GWAYGQAAHVPLTHGGVPVDTPDVQAAKAEHYAAHAKALGHV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 18/51 (35%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 18/49 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.