DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Cpr92A

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster


Alignment Length:232 Identity:89/232 - (38%)
Similarity:107/232 - (46%) Gaps:57/232 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LVKTALFVTLIGLA----------------------------QAGPLP----AKSSGSEDTYDSH 34
            ::|.:|...::|:|                            |.||||    |....:.:.||..
  Fly     1 MLKISLLSAMLGIAYAGVIGPGPYYGGPAGPGPLHHYGGYAPQHGPLPGPYVAPKPAAPEPYDPD 65

  Fly    35 PQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPL- 98
            |:|||.||:||..|||:|||.|:|.||||.|.|||.|.||.:||||||||...|||||||:||| 
  Fly    66 PKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEPLA 130

  Fly    99 ----SSAAVVVKPQATAV------VPKVQLKPLKKLPALK-PLSQASAVVHRSFAPVVHHAPVTH 152
                :..|.||.|....|      .|...|.|:.|.|.|. ||  |....||. ||    ||...
  Fly   131 YKAPAHLAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPLLSYPL--ALGPYHRG-AP----APAPG 188

  Fly   153 VVHHAAPAHSFVSHHVPVLKTTVHH------AHHPHA 183
            .....|||...|....|||.:...|      ||.|:|
  Fly   189 PAPAPAPAPVSVPVATPVLPSAHFHAAYPALAHSPYA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 34/51 (67%)
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 15/55 (27%)
Chitin_bind_4 68..120 CDD:278791 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.