DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Ccp84Ab

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:176 Identity:75/176 - (42%)
Similarity:92/176 - (52%) Gaps:35/176 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVV 93
            :.||.||||.|:|.|.|..|||.|.|.|.||||||.|:||:.|||||:|||.||||.:.||||||
  Fly    54 EEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVV 118

  Fly    94 RREPLSSAAVVVKPQATAVVPKVQLKPLKKLPALKPLSQASAVVHRSFAPVVHH---------AP 149
            .||||      ||..|.|.|.|....|:.:..|......|:..|.::.|||.|:         ||
  Fly   119 NREPL------VKAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAP 177

  Fly   150 VTHV------------VHHAAPAH------SFVSHHVPVLKTTVHH 177
            |.|.            .|:|||||      ::.|:..|.:  ..||
  Fly   178 VAHYAAPAAYATYAAPTHYAAPAHYAAPAATYTSYSAPAV--AYHH 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 32/51 (63%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440152
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.