DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Ccp84Ad

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:172 Identity:79/172 - (45%)
Similarity:101/172 - (58%) Gaps:18/172 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IGLAQAGPLPAKSSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYR 76
            :.:|.|.|:.||::   :.||.||||.:.|||||..:||.|||.|.||||||.|:||:.|||||:
  Fly    40 VAVAHAQPVLAKAA---EEYDPHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYK 101

  Fly    77 RTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLKPLKKLPALKPLSQASAVVHRSF 141
            |||.||||.:.||||||.||||      ||..|.|.|.|....|:....|......|:..|.::.
  Fly   102 RTVQYTADPINGFNAVVNREPL------VKAVAVAPVVKTVAAPVAHYAAPAVAHYAAPAVVKTV 160

  Fly   142 APVVHHA------PVTHVVHHAAPAHSFVSHHVPVLKTTVHH 177
            |||.|:|      .|..|.|:|||| ::.|:..|.:  ..||
  Fly   161 APVAHYAAPAVVKTVAPVAHYAAPA-TYTSYAAPAV--AYHH 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 33/51 (65%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440151
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.