DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Ccp84Ae

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:192 Identity:74/192 - (38%)
Similarity:104/192 - (54%) Gaps:20/192 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVKTALFVTLIG---------LAQAGPLP--AKSSGSEDTYDSHPQYSFNYDVQDPETGDVKSQ 54
            :::..|||....|         ...:.|:|  ||:...|:. |.||||:::|||||..:||.|..
  Fly     5 IVIALALFAVAHGAVLRTAAPVAVASAPVPVLAKTVELEEV-DPHPQYTYSYDVQDTLSGDNKGH 68

  Fly    55 SESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLK 119
            .|.||||||.|:||:.||||::|||.||||.:.||||||||||| :|.|..:|......|.|:..
  Fly    69 VEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPL-AAVVAAEPLLKVAAPLVKAA 132

  Fly   120 PLK-----KLPALKPLSQASAVVHRSFAPVVHHAPVTHVVHHAAPAHSFVSHHVPVLKTTVH 176
            |:.     .|.|..|:.:::.|.  ..||::..||:.........|...|:...|||:|..:
  Fly   133 PVAPIAPVALAAPAPIVRSAPVA--VAAPLIKSAPLAVAAPFVRSAPLAVAAPAPVLRTAAY 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 30/51 (59%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440146
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.