DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Cpr76Bc

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster


Alignment Length:270 Identity:77/270 - (28%)
Similarity:108/270 - (40%) Gaps:96/270 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ALFVTLIGL-AQAGPLPAKSSGS--------EDTYD-----SHPQYSFNYDVQDPETGDVKSQSE 56
            |:.:.||.| .:..|:.|...||        ::|.:     .|..|:|:|.|:|..|||||||.|
  Fly    11 AILLALICLGTRPPPIGAVRGGSPVVVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWE 75

  Fly    57 SRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQAT----------- 110
            |||||.|.|.|||.:.||..|||.||||..:||||:|:....:|..:...|:.:           
  Fly    76 SRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSHPITESPEGSNQVNDDTSQSK 140

  Fly   111 ---------AVVPKVQLKPLK-----------KLPAL---KP------------------LSQAS 134
                     .:|....:||||           |:|:|   ||                  |.||.
  Fly   141 INHYSKDQEHIVLSSDIKPLKRPIEDLTHSHPKVPSLIEIKPHARIKQVPMDMDPGIRDRLQQAR 205

  Fly   135 AVVHRSFA------------------------PVVHHAPVTHVVHH--AAPAHS-FVSHHVPVLK 172
            ...::..|                        .|:.:.|..:..|:  .:|||| |..|:.|  |
  Fly   206 DTYYKQIAAAHKLEDYSQKLQPTYAVQEGDWKAVIVNEPKEYRPHYTTGSPAHSHFYDHYKP--K 268

  Fly   173 TTVH-HAHHP 181
            ...| :.|.|
  Fly   269 EIPHNYIHKP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 32/51 (63%)
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.