DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Cpr66D

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster


Alignment Length:112 Identity:42/112 - (37%)
Similarity:59/112 - (52%) Gaps:14/112 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TLIGLAQAGPLPAKSSGSEDTY-DSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDAD 73
            :::|..| ..|..:....|:.| |.:..|.|.:||:|.|..:.:::.|.|||.|:.|.|||.|:|
  Fly   131 SILGKGQ-HKLSLQQQNEEEEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSD 194

  Fly    74 GYRRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLKP 120
            |:.|||.||||...||.|.|.|||            |.:|.|:...|
  Fly   195 GFIRTVKYTADPKEGFKAEVIREP------------TDIVVKIPTPP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 25/51 (49%)
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.