DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Acp65Aa

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:96 Identity:26/96 - (27%)
Similarity:41/96 - (42%) Gaps:11/96 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVKTALFVTLIGLAQAGP---LPAKSSGSEDTYDSHPQYSFNYDVQD----PETGDVKSQSESR 58
            |||..:: ..|:.||.|.|   :......||:|  ....|.|:|.:.|    .|.|.|.:.....
  Fly     5 MLVVGSI-ALLLALASARPQNDVEVLEYESENT--GLGGYKFSYKLSDGTSRTEEGVVNNAGTDN 66

  Fly    59 DGDVVHGQYSVNDADGYRRTVDYTADDVRGF 89
            :...:.|..:....||...|:::.||: .||
  Fly    67 ESISIRGSVTWVAPDGQTYTINFVADE-NGF 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 13/55 (24%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:278791 13/55 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.