DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Acp65Aa

DIOPT Version :10

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:96 Identity:26/96 - (27%)
Similarity:41/96 - (42%) Gaps:11/96 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVKTALFVTLIGLAQAGP---LPAKSSGSEDTYDSHPQYSFNYDVQD----PETGDVKSQSESR 58
            |||..:: ..|:.||.|.|   :......||:|  ....|.|:|.:.|    .|.|.|.:.....
  Fly     5 MLVVGSI-ALLLALASARPQNDVEVLEYESENT--GLGGYKFSYKLSDGTSRTEEGVVNNAGTDN 66

  Fly    59 DGDVVHGQYSVNDADGYRRTVDYTADDVRGF 89
            :...:.|..:....||...|:::.||: .||
  Fly    67 ESISIRGSVTWVAPDGQTYTINFVADE-NGF 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:459790 13/55 (24%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 13/55 (24%)

Return to query results.
Submit another query.