DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Cpr64Ac

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:100 Identity:44/100 - (44%)
Similarity:58/100 - (57%) Gaps:0/100 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AGPLPAKSSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDY 81
            |.|:........:.||.:|||||:|.|.|..|||.|.|.|:....||||.||:.:.||..|.|.|
  Fly    72 AAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTY 136

  Fly    82 TADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKV 116
            |||.|.||||||.::.:::.|:.....|.|.||.:
  Fly   137 TADKVNGFNAVVEKKGVAAVAIAKPALAVAAVPAI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 27/51 (53%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.