DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Cpr64Ab

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster


Alignment Length:117 Identity:59/117 - (50%)
Similarity:70/117 - (59%) Gaps:5/117 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LVK-TALFVTLIGLAQAGPLPAK---SSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDV 62
            |:| |.:...||...:...|||.   ........|.||||:|.|:|||..|||.|||.|.|||||
  Fly     3 LIKITLICCALIAAIECALLPAAVPVGVPLNTEVDPHPQYAFAYNVQDALTGDSKSQQEVRDGDV 67

  Fly    63 VHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPLSSAA-VVVKPQATAVV 113
            |.|.|||.||||..|||.||||.:.||||||:|.|:..|| .:|.|.|..::
  Fly    68 VKGSYSVVDADGSLRTVFYTADPINGFNAVVQRGPVPVAARPLVAPVAAPIL 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 34/51 (67%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.