DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Cpr64Aa

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:179 Identity:78/179 - (43%)
Similarity:98/179 - (54%) Gaps:15/179 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VKTALFVTLIGLA------------QAGPLPAKSSGSEDTYDSHPQYSFNYDVQDPETGDVKSQS 55
            |.:|:.|...|||            .|.||.||.:|.| .||.:|||:|:|||.|..|||||||.
  Fly    15 VSSAVVVPGPGLALPAYPSYPALAKVAAPLVAKVAGPE-PYDPNPQYTFSYDVHDGSTGDVKSQQ 78

  Fly    56 ESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLKP 120
            |:|.||||.|.||:.:|||.||.|:||||.|.|||||||||.....||....:..|..|.:...|
  Fly    79 ETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRREGAVVKAVAPVAKVLAPAPLLHASP 143

  Fly   121 L-KKLPALKP-LSQASAVVHRSFAPVVHHAPVTHVVHHAAPAHSFVSHH 167
            | .|:||..| |:.|...:...:.|.:..|....:...|.||.|.:.:|
  Fly   144 LVAKVPAYGPALAPAYPALAHGYGPALAPAYGPALPKLALPALSPLGYH 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 33/51 (65%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.