DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Cpr57A

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001137721.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster


Alignment Length:133 Identity:41/133 - (30%)
Similarity:56/133 - (42%) Gaps:19/133 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YSFNYDV-QDPETGDVKSQ-SESRDGD-VVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPL 98
            |.|:|.. :.|  |.|..| :|..||. |:.|.:|..|.....|||.|.||: .||:..:..:..
  Fly    32 YVFSYQAGRAP--GHVDRQHTEVSDGSGVIRGAFSYVDPKNQVRTVQYVADE-HGFHPQLSHKLE 93

  Fly    99 SSAAV-VVKPQATAVVPKVQLKPLKKLPALKPLSQASAVVHRSFAPVVHHAPVTHV-------VH 155
            .|||| ..|.:..|...::..:.....|....|:.|.   |.|.|  |.||...|:       ..
  Fly    94 DSAAVQAAKQRHFAAYNRIAQEHANHTPGQVALANAP---HASAA--VAHATQKHLSAFERIAAE 153

  Fly   156 HAA 158
            |||
  Fly   154 HAA 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 20/54 (37%)
Cpr57ANP_001137721.1 Chitin_bind_4 32..84 CDD:278791 20/54 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.