powered by:
Protein Alignment Edg84A and Cpr49Ah
DIOPT Version :9
Sequence 1: | NP_524247.1 |
Gene: | Edg84A / 40818 |
FlyBaseID: | FBgn0000552 |
Length: | 188 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610777.1 |
Gene: | Cpr49Ah / 36354 |
FlyBaseID: | FBgn0033731 |
Length: | 190 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 23/70 - (32%) |
Similarity: | 34/70 - (48%) |
Gaps: | 4/70 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 KSSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVV-HGQYSVNDADGYRRTVDYTADDV 86
|....:.:|.: :|.....:...|||.:|....:.:|.:| |||||....:|....|.||||:
Fly 58 KEQSDDGSYKT--EYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADE- 119
Fly 87 RGFNA 91
.||.|
Fly 120 NGFRA 124
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.