DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Cpr30B

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster


Alignment Length:130 Identity:54/130 - (41%)
Similarity:69/130 - (53%) Gaps:20/130 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPLSSA 101
            |.|.:.|.||.|||:|||.|||..|.|.|.|.:.|:|||||.|.|.|||..||.|:|:|||... 
  Fly    33 YEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDI- 96

  Fly   102 AVVVKPQATAVVPKVQL-KPLKKLPALKPLSQASAVVHRSFAPVVHHAPVTHVVHHAAPAHSFVS 165
                         |:.| :|.|||.|.|.|:....|     ||:||:|....::.....|.::||
  Fly    97 -------------KIPLPEPPKKLLAAKILTPVLPV-----APLVHYAAPKAIIKQELSAGNYVS 143

  Fly   166  165
              Fly   144  143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 29/51 (57%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453203
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.