DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and AgaP_AGAP010109

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_554005.2 Gene:AgaP_AGAP010109 / 3292125 VectorBaseID:AGAP010109 Length:140 Species:Anopheles gambiae


Alignment Length:111 Identity:57/111 - (51%)
Similarity:67/111 - (60%) Gaps:14/111 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AGPLPAKSSGSEDTYDSHPQ------YSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGY 75
            |.|...||. ::.||....:      |.|:|.|.|..|||||||.|:|.||.|.||||:.||||:
Mosquito    33 AQPALVKSY-AQPTYVKQVEEYAPANYEFSYSVHDSHTGDVKSQHETRHGDQVQGQYSLLDADGH 96

  Fly    76 RRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLKPL 121
            ||.|||||||..||||||||||.:  ..|.:|     |.||..:||
Mosquito    97 RRIVDYTADDHNGFNAVVRREPAN--VKVAQP-----VQKVIAQPL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 34/51 (67%)
AgaP_AGAP010109XP_554005.2 Chitin_bind_4 58..110 CDD:278791 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.