DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CPR4

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_551138.2 Gene:CPR4 / 3290498 VectorBaseID:AGAP001667 Length:246 Species:Anopheles gambiae


Alignment Length:227 Identity:84/227 - (37%)
Similarity:115/227 - (50%) Gaps:48/227 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVKTALFVTLIGLAQAGPL--PAKS---------------------------SGSEDTYDSHPQ 36
            |..|..:|..::.:|:||.:  ||.|                           :...:.||::||
Mosquito     1 MAFKFVIFAAVVAVARAGLIASPAVSYAAAPALVAAPVAKVAYAAAPIAKVAYAAQPEEYDANPQ 65

  Fly    37 YSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPLSSA 101
            |||:|.:.|..|||.|||.|||.||||.|.|||.|.||.:||||||||...|||||||||||::.
Mosquito    66 YSFSYGISDALTGDSKSQQESRSGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAVVRREPLAAK 130

  Fly   102 AVV-VKPQATAVV--PKVQLKPLKKLPALKPLSQASAVVHRSFA--PVVHH-APVTH------VV 154
            .:| ..|.||.|:  |.|..    ..|..|.:|.|:.|..:::.  |.:.: ||:|.      .:
Mosquito   131 TIVAAAPVATKVIAQPAVAY----AAPVAKTISYAAPVATKTYVAQPALSYAAPLTKTYVSQPAL 191

  Fly   155 HHAAPAHSFVSHHVPVLKTTVHHAHHPHAISY 186
            .:|||....:|:..|:...|  :...| ||||
Mosquito   192 SYAAPVAKTISYSAPLATKT--YVSQP-AISY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 33/51 (65%)
CPR4XP_551138.2 Chitin_bind_4 66..118 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12236
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.