| Sequence 1: | NP_524247.1 | Gene: | Edg84A / 40818 | FlyBaseID: | FBgn0000552 | Length: | 188 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_551141.1 | Gene: | CPR1 / 3290497 | VectorBaseID: | AGAP001664 | Length: | 204 | Species: | Anopheles gambiae |
| Alignment Length: | 228 | Identity: | 77/228 - (33%) |
|---|---|---|---|
| Similarity: | 98/228 - (42%) | Gaps: | 75/228 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MLVKTALFVTLIGLAQAGPL--PAKS----------------------------------SGSED 29
Fly 30 TYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVR 94
Fly 95 REPLSSAAVVVKPQATAVVPKVQLKPLKKLPALKPLSQASAVVHRSFAPVVHHAPVTHVVHHAAP 159
Fly 160 -------AHSFVSHHVPVLK--------TTVHH 177 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Edg84A | NP_524247.1 | Chitin_bind_4 | 37..89 | CDD:278791 | 32/51 (63%) |
| CPR1 | XP_551141.1 | Chitin_bind_4 | 73..125 | CDD:278791 | 32/51 (63%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2C9WU | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 1 | 1.000 | - | - | H43711 | |
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1544103at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR12236 |
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.920 | |||||