DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and Cpr30F

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster


Alignment Length:144 Identity:64/144 - (44%)
Similarity:77/144 - (53%) Gaps:16/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVKTALFVTLIGLAQAGPLPAKSSGS----------EDTYDSHPQYSFNYDVQDPETGDVKSQS 55
            |....:||:..:|.|.|..||...|.:          |....:|  |.|.|.|.|..|||:|||:
  Fly     1 MFALVSLFILGVGAAAAIELPIYHSPAAIVKPLLKTVEVEAPAH--YDFAYSVHDEHTGDIKSQT 63

  Fly    56 ESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPLS----SAAVVVKPQATAVVPKV 116
            |||.||.|.|||::.|||||.||||||:|...||||||||:||.    .||.:.|..|.|.:|..
  Fly    64 ESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVRRDPLGQKVIKAAPIAKLLAPAPLPLA 128

  Fly   117 QLKPLKKLPALKPL 130
            ...|....||..||
  Fly   129 YAAPKLLAPAKLPL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 32/51 (63%)
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:395303 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453207
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.