DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CG32603

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster


Alignment Length:205 Identity:52/205 - (25%)
Similarity:75/205 - (36%) Gaps:51/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTALFVTLIGLAQAGPLPAKSS-------GSEDTYDSH----PQYSF---NYDVQDPETGDVKSQ 54
            |:|...|.....||.|:.|.:|       .:..||:|.    |..||   :|.........|::.
  Fly    30 KSAAASTSYESYQAAPVEAAASETYVAPAAAASTYESESYSAPAASFTSESYAAPAAVEAAVETA 94

  Fly    55 SESRDGDVVHGQYSVNDADGYRRTV----DYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPK 115
            :|         :.:...|..|...|    .|:|..|..:::      .|:.|||.|......|.|
  Fly    95 AE---------ETNEQPAASYVAPVVTKTTYSAPAVSSYSS------YSAPAVVAKTYTAPAVVK 144

  Fly   116 VQLKP---LKKLPALKPLSQ---ASAVVHRSFAPVV--HHAPVTHVVH--------HAAPAHSFV 164
            ....|   ....||:...||   |.|||....||.|  :.|||....:        :.|||.|  
  Fly   145 TYSAPAVSTYSAPAVSGYSQTYTAPAVVKTYSAPAVSTYTAPVVTKTYTAPVVAKTYTAPAVS-- 207

  Fly   165 SHHVPVLKTT 174
            ::..||:..|
  Fly   208 TYTAPVVAKT 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 11/58 (19%)
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 42/170 (25%)
rne <109..299 CDD:236766 33/117 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.