DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CPR85

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_319255.3 Gene:CPR85 / 1279527 VectorBaseID:AGAP010101 Length:180 Species:Anopheles gambiae


Alignment Length:201 Identity:75/201 - (37%)
Similarity:96/201 - (47%) Gaps:34/201 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVKTALFVTLIGLAQ-AGPLPAKSSGSEDTYDSH--PQYSFNYDVQDPETGDVKSQSESRDGDV 62
            |:.|..:.|.|:..|. |...|.    :...|..|  .:|.|.|.|.|..:||:|.|.|.|.||.
Mosquito     1 MMEKVCIAVFLVVAASTAAAFPV----ARQLYGEHGPVEYHFKYSVHDDRSGDIKHQQEERHGDK 61

  Fly    63 VHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLKPLKKLPAL 127
            |.||||:||||||||.||||:|...||.|.||||.:............:|||.|:|  ||.|| |
Mosquito    62 VTGQYSLNDADGYRRVVDYTSDKDTGFVANVRRELIKGFHQTTSSTKASVVPVVEL--LKSLP-L 123

  Fly   128 KPLSQASAVVH-RSFAPV--VHHAPVTHVVHHAAPAHSFVSHHVPVLKTTVH-HAHHPHA----- 183
            .|::.     | .||.||  .|:..    ||...|..|     .|::.|:.: :..|.|.     
Mosquito   124 VPINP-----HIESFHPVEQAHYVK----VHKVTPKLS-----EPIVYTSKNRNTVHSHTSFKSG 174

  Fly   184 -ISYVF 188
             |||.:
Mosquito   175 NISYQY 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 31/51 (61%)
CPR85XP_319255.3 Chitin_bind_4 36..88 CDD:278791 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12236
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.