DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CPR106

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_316152.4 Gene:CPR106 / 1276767 VectorBaseID:AGAP006095 Length:150 Species:Anopheles gambiae


Alignment Length:153 Identity:43/153 - (28%)
Similarity:67/153 - (43%) Gaps:29/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVKTALFVTLIGLAQAGPL----PAKSSGSEDTYDSHPQ-------YSFNYDVQDPETGDVKSQ 54
            :|:..||.:||  .|...||    |.....||.|..:..|       |::||:.    :..:|::
Mosquito     7 ILLSCALALTL--AAPPAPLTKRSPQGGPDSEATVVAQDQIINEGGSYAYNYET----SNGIKAR 65

  Fly    55 SESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLK 119
            ..|.:|...:|:||....||...:|.|.||: .||      :| ..|.:..:|.|...|.|: |:
Mosquito    66 QTSDNGVSANGEYSFLAPDGTSYSVVYVADE-NGF------QP-QGAHLPTEPPAPEHVIKL-LE 121

  Fly   120 PLKKLPALKP---LSQASAVVHR 139
            .|:..|...|   |:...|.:.|
Mosquito   122 DLRANPPSDPEFDLASLDATLAR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 15/51 (29%)
CPR106XP_316152.4 Chitin_bind_4 52..99 CDD:278791 15/51 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.