DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CPR22

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_316037.1 Gene:CPR22 / 1276667 VectorBaseID:AGAP005997 Length:106 Species:Anopheles gambiae


Alignment Length:93 Identity:27/93 - (29%)
Similarity:41/93 - (44%) Gaps:9/93 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VKTALFVTLIGL-AQAGPLPAKSSGSEDTYDSHPQYSFNYDVQD----PETGDVKSQSESRDGDV 62
            :||.:.:.||.: |.|.....|....|:..|....|.|.::..|    .|.|::|::.|   |..
Mosquito     1 MKTLIVLALIAIVAVAADQNTKVLRYENVQDGDASYKFAFESDDGIARQEQGELKTEEE---GMN 62

  Fly    63 VHGQYSVNDADGYRRTVDYTADDVRGFN 90
            |.|.:.....||....|.|.||. :||:
Mosquito    63 VQGNFKFVADDGKEYVVQYVADS-QGFH 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 16/55 (29%)
CPR22XP_316037.1 Chitin_bind_4 36..88 CDD:278791 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.