DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and LOC1273355

DIOPT Version :10

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_312322.1 Gene:LOC1273355 / 1273355 VectorBaseID:AGAMI1_001204 Length:137 Species:Anopheles gambiae


Alignment Length:69 Identity:22/69 - (31%)
Similarity:31/69 - (44%) Gaps:9/69 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YSFNYDVQD----PETGDVKSQSESRDGDV----VHGQYSVNDADGYRRTVDYTADDVRGFNAVV 93
            |.|.|::.|    .|.|..:...::...||    |.|.||....||....|:||||: .|::..|
Mosquito    55 YKFTYELSDGQIRSEVGTYRDVKDAEGKDVKALFVQGSYSFVGPDGQTYWVNYTADE-NGYHPKV 118

  Fly    94 RREP 97
            ...|
Mosquito   119 GTGP 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:459790 19/59 (32%)
LOC1273355XP_312322.1 Chitin_bind_4 55..114 CDD:459790 19/59 (32%)

Return to query results.
Submit another query.