powered by:
Protein Alignment Edg84A and CPR8
DIOPT Version :9
Sequence 1: | NP_524247.1 |
Gene: | Edg84A / 40818 |
FlyBaseID: | FBgn0000552 |
Length: | 188 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_312322.1 |
Gene: | CPR8 / 1273355 |
VectorBaseID: | AGAP002613 |
Length: | 137 |
Species: | Anopheles gambiae |
Alignment Length: | 69 |
Identity: | 22/69 - (31%) |
Similarity: | 31/69 - (44%) |
Gaps: | 9/69 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 YSFNYDVQD----PETGDVKSQSESRDGDV----VHGQYSVNDADGYRRTVDYTADDVRGFNAVV 93
|.|.|::.| .|.|..:...::...|| |.|.||....||....|:||||: .|::..|
Mosquito 55 YKFTYELSDGQIRSEVGTYRDVKDAEGKDVKALFVQGSYSFVGPDGQTYWVNYTADE-NGYHPKV 118
Fly 94 RREP 97
...|
Mosquito 119 GTGP 122
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.