DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CPR10

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_311895.3 Gene:CPR10 / 1272964 VectorBaseID:AGAP002994 Length:200 Species:Anopheles gambiae


Alignment Length:144 Identity:54/144 - (37%)
Similarity:69/144 - (47%) Gaps:40/144 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRR 95
            || ...||:.|.|:|..:||:|||.|.|:||.|.|||...::||..|.||||||||||||||||.
Mosquito    86 YD-RDDYSYGYAVRDELSGDIKSQQEVRNGDRVRGQYRTLESDGTERIVDYTADDVRGFNAVVRH 149

  Fly    96 EPLSSAAVVVKPQATAVVPKVQLKPLKKLPALKPLSQASAVVHRSFAPVVHHAPVTHVVHHAAPA 160
            :|             :|..:.||     :..|:|            |.::....|.|:|.     
Mosquito   150 QP-------------SVGTRAQL-----VHTLQP------------AVLLRQPTVGHLVS----- 179

  Fly   161 HSFVSHHVPVLKTT 174
                ..|.|.|.||
Mosquito   180 ----GQHRPALLTT 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 30/51 (59%)
CPR10XP_311895.3 Chitin_bind_4 91..138 CDD:278791 25/46 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12236
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.