DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CPR122

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_311670.4 Gene:CPR122 / 1272762 VectorBaseID:AGAP003384 Length:138 Species:Anopheles gambiae


Alignment Length:138 Identity:58/138 - (42%)
Similarity:72/138 - (52%) Gaps:20/138 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVKTALFVTLIGLAQA---------GPLP--AKSSGSEDTYDSHPQYSFNYDVQDPETGDVKSQ 54
            |.::.|:....:..|.|         |..|  ||.:.....||.:||||::|.|.|..|||.|||
Mosquito     1 MALRFAVLAAFVATASAVAIGYPAPYGAYPAVAKVAAPLADYDPNPQYSYSYAVSDALTGDNKSQ 65

  Fly    55 SESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLK 119
            .|||.||||.|.||:.:.||.:|.|:||||.|.||||||.|     .|.|||    ||.|..:..
Mosquito    66 QESRSGDVVSGSYSLIEPDGTQRVVEYTADPVNGFNAVVHR-----GAGVVK----AVAPVAKFA 121

  Fly   120 PLKKLPAL 127
            .....||:
Mosquito   122 APLAYPAV 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 30/51 (59%)
CPR122XP_311670.4 Chitin_bind_4 48..100 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12236
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.