DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CPR130

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_311111.4 Gene:CPR130 / 1272228 VectorBaseID:AGAP000047 Length:354 Species:Anopheles gambiae


Alignment Length:247 Identity:61/247 - (24%)
Similarity:81/247 - (32%) Gaps:95/247 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AKSSGS------EDTYDSHP---QYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRR 77
            |.:|||      ...|.:|.   .||:.|    .|....|.:::...| :.||.||..||:|:.:
Mosquito    16 AAASGSYLGVALSSQYQAHDGIGGYSYGY----AEPNSQKHETKDAHG-ITHGGYSYVDANGHVQ 75

  Fly    78 TVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAV---------------------VPKVQLKP- 120
            :|.||||.:.||.......|...|     |.|..|                     .|:||... 
Mosquito    76 SVKYTADPIHGFQVSGTNLPKGPA-----PHAVPVPAWNAYAYAPVVLGHNGAPLETPEVQAAKA 135

  Fly   121 ------------LKKLPALKPLSQASA----------------VVH--------------RSFAP 143
                        |.|.....|.:.|:|                |.|              .::||
Mosquito   136 AHFAAHAAAKARLHKRSLYAPWTYAAAAPVVLGHNGVPLDTPEVAHAKAEHAAAHAKALGHAYAP 200

  Fly   144 V--------VHHAPVTHVVHHAAPAHSFVSHHVPVLKTTVHHAHHP-HAISY 186
            .        |.||...|:..|||   :..:||.....|||.|.||. ||..|
Mosquito   201 AGPVPDTPEVQHAKAAHLAAHAA---ARANHHAVAPVTTVAHTHHAVHAAHY 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 18/51 (35%)
CPR130XP_311111.4 Chitin_bind_4 40..87 CDD:278791 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.