DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CPF1

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_309789.3 Gene:CPF1 / 1271045 VectorBaseID:AGAP010900 Length:238 Species:Anopheles gambiae


Alignment Length:249 Identity:55/249 - (22%)
Similarity:78/249 - (31%) Gaps:82/249 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVKTALFVTLIGLAQAGPLPAKSSGSEDTYDSH--PQYSFNYD--------------------- 42
            |..|..:|:..:.:|.||.|.|..:.......:|  |..|.:|.                     
Mosquito     1 MAFKFVVFLASLAVASAGYLEAGHAVQYAAPVAHYSPASSVSYSTISQAAPAKLAYAAPVAKTIS 65

  Fly    43 ----------------------VQDPETGDV-KSQSESRDGDVVHGQYSVNDADGYRRTVDYTAD 84
                                  |..|..|.. :|...|.||.:.|          |.:.||....
Mosquito    66 YAAPQVYAAPQVYAAAPVAKTIVSSPAVGATHESTIRSHDGTISH----------YSKAVDTAFS 120

  Fly    85 DVRGFNAVVRRE-PLSSAA--VVVKPQATAVVPKVQLKPLKKLPALKPLSQASAVVHRSFAPVVH 146
            .||..:..:..| |..:.|  |:.|..|.|..|.|........||....:.|:..||.|:|   |
Mosquito   121 SVRKSDTRITNELPKYAYAQPVLAKQVAYAAAPAVHTTYTHAAPAAVHTTYAAPAVHTSYA---H 182

  Fly   147 HAPVTHVVHHAAPA--HSFVSHHVPVLKTTVH------------------HAHH 180
            .||......:||||  .::.:|..||:.|...                  |||:
Mosquito   183 AAPAAVHTTYAAPAAVQTYAAHAAPVVATATKTLTYSPAVQVAHTTYEDAHAHY 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 15/95 (16%)
CPF1XP_309789.3 Cuticle_3 89..238 CDD:287932 42/161 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.