DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and CPR55

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_308909.2 Gene:CPR55 / 1270230 VectorBaseID:AGAP006837 Length:152 Species:Anopheles gambiae


Alignment Length:116 Identity:45/116 - (38%)
Similarity:69/116 - (59%) Gaps:17/116 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNA 91
            |:|.| ::|:|.|.|.|:||.|||.|||.|.||||:|.|.|::::.||.:|.|:|.|||..||.|
Mosquito    48 SQDYY-AYPKYQFEYGVKDPLTGDHKSQWEMRDGDIVKGSYTLDEPDGTQRIVEYRADDRNGFEA 111

  Fly    92 VVRREPLSSAAVVVKPQATAVVPKVQLKPLKKLPALKPLSQASAVVHRSFA 142
            :|::        :.||:        .|:.|.|..|:|..:....:|.:|::
Mosquito   112 IVKK--------IGKPK--------HLEELGKQLAVKQAADTHHIVGQSYS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 28/51 (55%)
CPR55XP_308909.2 Chitin_bind_4 57..109 CDD:278791 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.