powered by:
Protein Alignment Edg84A and CPR67
DIOPT Version :9
Sequence 1: | NP_524247.1 |
Gene: | Edg84A / 40818 |
FlyBaseID: | FBgn0000552 |
Length: | 188 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_308908.3 |
Gene: | CPR67 / 1270229 |
VectorBaseID: | AGAP006839 |
Length: | 244 |
Species: | Anopheles gambiae |
Alignment Length: | 67 |
Identity: | 39/67 - (58%) |
Similarity: | 49/67 - (73%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 DTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVV 93
|.|:::|:|||.|.|.||.|||.|.|.|.||||||.|.|.:.:|||..|.|:||:||..||||||
Mosquito 132 DEYNAYPKYSFEYGVDDPHTGDHKKQWEFRDGDVVKGGYMLKEADGTTRVVEYTSDDHNGFNAVV 196
Fly 94 RR 95
::
Mosquito 197 KK 198
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2C9WU |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.