DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and AgaP_AGAP006860

DIOPT Version :9

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_308896.4 Gene:AgaP_AGAP006860 / 1270217 VectorBaseID:AGAP006860 Length:120 Species:Anopheles gambiae


Alignment Length:89 Identity:40/89 - (44%)
Similarity:54/89 - (60%) Gaps:7/89 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFVTLIGLAQAGPLPAKSSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVND 71
            :||.|..|...       :.:.|.|.::|.|.|.|.|:||.|||.|||.|.||||||.|.|::::
Mosquito     4 VFVALAALVAV-------TAAVDDYYAYPSYKFEYGVKDPHTGDHKSQWEHRDGDVVKGVYTLHE 61

  Fly    72 ADGYRRTVDYTADDVRGFNAVVRR 95
            |||..|.|:|::|...||.|.|:|
Mosquito    62 ADGTERVVEYSSDKHNGFQAHVKR 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 28/51 (55%)
AgaP_AGAP006860XP_308896.4 Chitin_bind_4 27..79 CDD:278791 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.