DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg84A and LOC1270212

DIOPT Version :10

Sequence 1:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_308891.3 Gene:LOC1270212 / 1270212 VectorBaseID:AGAMI1_011125 Length:137 Species:Anopheles gambiae


Alignment Length:74 Identity:41/74 - (55%)
Similarity:50/74 - (67%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AKSSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDV 86
            ||..|..|.| |||.|.|.|.|:||.|||.|||.|.||||||.|.|::::|||..|.|:|::|..
Mosquito    30 AKHHGHHDYY-SHPSYKFEYGVKDPHTGDHKSQWEHRDGDVVKGAYTLHEADGTERVVEYSSDKH 93

  Fly    87 RGFNAVVRR 95
            .||.|.|:|
Mosquito    94 NGFQAHVKR 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:459790 28/51 (55%)
LOC1270212XP_308891.3 None

Return to query results.
Submit another query.