DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and YHP1

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_010739.3 Gene:YHP1 / 852062 SGDID:S000002859 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:390 Identity:79/390 - (20%)
Similarity:112/390 - (28%) Gaps:187/390 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 HGLPHGH----------LGNLANNPHQQQPQVQQQQQQPHQQP---QHPQNQSPAAHQQHHQNSV 342
            |.||:.:          |..||.:.|..:|.|     ..::.|   :.|:.:||.|.....|.  
Yeast    26 HTLPNTNFPSDDQGDIRLPPLAASAHIVRPVV-----NIYKSPCDEERPKRKSPQAVDFLSQR-- 83

  Fly   343 SPNGGMNRQQRGGVISPGSSTSSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAP 407
                               .|:|.|       |.|...|..:||...||.      |...|.|.|
Yeast    84 -------------------VTTSMT-------PLSKPKKLSSHSPFTPTV------RVCSKEQPP 116

  Fly   408 KLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAA 472
            :       |||.|:                                       :.:::...|||.
Yeast   117 Q-------SMHSYK---------------------------------------KVNILTPLSAAK 135

  Fly   473 AGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNF---TNKQLTELEKEFHF-NRYLTR----- 528
            |                     .|:..|....:.:|   |:.|.|..:||... |..|.|     
Yeast   136 A---------------------VLTPTTRKEKKRSFAFITHSQETFPKKEPKIDNARLARRKRRR 179

  Fly   529 ---------------------ARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIPADILTQ 572
                                 |:|||::....::|..|:|||||:|...||....|      .|.
Yeast   180 TSSYELGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKKHKNSG------NTS 238

  Fly   573 H-------STSVISEKPPQQQQPQPPELQLKSQGSDLGGNELATGAPSTPT-TAMTLTAPTSKQS 629
            |       |.|:||.                        ::.|....|||| |...:||...|.|
Yeast   239 HCKVHSNDSMSMISY------------------------SDAALEITSTPTSTKEAITAELLKTS 279

  Fly   630  629
            Yeast   280  279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 21/81 (26%)
YHP1NP_010739.3 COG5576 123..278 CDD:227863 44/244 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.