DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and HB22

DIOPT Version :10

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_850266.1 Gene:HB22 / 818233 AraportID:AT2G36610 Length:185 Species:Arabidopsis thaliana


Alignment Length:117 Identity:34/117 - (29%)
Similarity:52/117 - (44%) Gaps:14/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 SGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFH--------FNRYLTRARRIEIANTLQLNETQV 545
            ||....|.|.|.....:...|::||..||:.|.        ....|...|:::::..|.|...|:
plant    56 SGYGEESNSFNGQEKKKKKMTSEQLKFLERSFQEEIKLNPDRKMKLNPDRKMKLSKELGLQPRQI 120

  Fly   546 KIWFQNRRMKQKKRVKEGLIPADILTQHSTSVISEKPPQQQQPQPPELQLKS 597
            .:|||||:.:.|.:..|.|.  :.|.|....|..||...|::    .:||||
plant   121 AVWFQNRKARWKNKQLEHLY--ESLRQEFDIVSREKELLQEE----LIQLKS 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeodomain 505..558 CDD:459649 16/60 (27%)
HB22NP_850266.1 Homeodomain 70..133 CDD:459649 16/62 (26%)
HALZ 134..167 CDD:460477 12/39 (31%)

Return to query results.
Submit another query.