DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and gsx1

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001039254.1 Gene:gsx1 / 734120 XenbaseID:XB-GENE-855502 Length:243 Species:Xenopus tropicalis


Alignment Length:130 Identity:52/130 - (40%)
Similarity:63/130 - (48%) Gaps:22/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 PGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGL--------------------SSCSL 496
            |||..:.:..:|.......|..|..|....|:.:..|..|                    |...|
 Frog    70 PGIPLLKASFSSFGTQYCPAGLGRQHSASTGINVSHGPALYQAAYPLPDPRQFHCISVDSSPSQL 134

  Fly   497 SSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVK 561
            ||:...  ||.||:.||.|||:||..|.||:|.||||||..|.|:|.||||||||||:|.||..|
 Frog   135 SSSKRM--RTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGK 197

  Fly   562  561
             Frog   198  197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 35/51 (69%)
gsx1NP_001039254.1 homeobox 137..196 37/60 (62%)
Homeobox 141..194 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.