DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Mnx1

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001258203.1 Gene:Mnx1 / 682076 RGDID:1588091 Length:403 Species:Rattus norvegicus


Alignment Length:345 Identity:97/345 - (28%)
Similarity:135/345 - (39%) Gaps:126/345 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 SVSPNGGMNRQQRGGVISPGSSTSSSTSASNGAHPASTQ-SKSPNHSSSIPTYKWMQLKRNVPKP 404
            :.:|:|    ..|||  |.|..|||  .||....|||:: :.:|..          :|:...|.|
  Rat    35 AATPSG----PGRGG--SGGGGTSS--GASRSCSPASSEATAAPGD----------RLRAESPSP 81

  Fly   405 QAPKLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGP-------------------------- 443
              |:|..:..|.:   ...|.|     |.|||.|...||                          
  Rat    82 --PRLLTAHCALL---PKPGFL-----GAGGGGGAAGGPGTPHHHAHPGAAAAAAAAAAAAAAGG 136

  Fly   444 --VGVGGNGSPGIGGVLSVQNSL----IMANSAAAAGSA-----------HPNGMG--------- 482
              :|:...|:.| |..|..|.:|    :.:.|||||.:|           :|...|         
  Rat   137 LALGLHPGGAQG-GAGLPAQAALYGHPVYSYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADP 200

  Fly   483 VGLGSGS-----------------GLSSCSLSSNTNNSG-----RTNFTNKQLTELEKEFHFNRY 525
            :.||:|:                 .:...|..:.:|..|     ||.||::||.|||.:|..|:|
  Rat   201 IKLGAGTFQLDQWLRASTAGMILPKMPDFSSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKY 265

  Fly   526 LTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIPADILTQHSTSVISEKPPQQQQPQP 590
            |:|.:|.|:|.:|.|.||||||||||||||.|:                     .|..::|..|.
  Rat   266 LSRPKRFEVATSLMLTETQVKIWFQNRRMKWKR---------------------SKKAKEQAAQE 309

  Fly   591 PELQLKS-QGSDLGGNELAT 609
            .|.|..| .|:..||.|..|
  Rat   310 AEKQKGSGGGAGKGGTEEKT 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 33/51 (65%)
Mnx1NP_001258203.1 Homeobox 244..297 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.