DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and hoxa5a

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_571615.1 Gene:hoxa5a / 58055 ZFINID:ZDB-GENE-000823-9 Length:227 Species:Danio rerio


Alignment Length:298 Identity:83/298 - (27%)
Similarity:104/298 - (34%) Gaps:102/298 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 AGSYA--LDAMDSLGMHAHMHHGLPHG-----HLGNLANNPHQQQPQVQQQQQQPHQQ--PQHPQ 327
            :|.||  .:.||....|:...|.|..|     :..:....|.:....|.....:|...  |....
Zfish     3 SGRYACGYNGMDLSTGHSSPGHFLSSGERTQSYKDSPTATPVRYNQPVTASSAEPSSDHLPCSSL 67

  Fly   328 NQSPAAHQQHH--QNSVSPNGGMNRQQRGGVISPGSSTSSSTSASNGAHPASTQSKSPNHSSSIP 390
            ..||.:.|.|.  :.|:|...|...:..|.|:|....:..|:|......|.|.|:.|.|.|.:..
Zfish    68 ANSPVSEQSHRALKISLSSTAGSASKSFGTVLSREGVSKVSSSMEEEKPPGSGQTASQNVSEAPQ 132

  Fly   391 TYKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIG 455
            .|.||:           ||..|     ||                                    
Zfish   133 IYPWMR-----------KLHIS-----HD------------------------------------ 145

  Fly   456 GVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEF 520
                              ..|.|.|                     ...||.:|..|..||||||
Zfish   146 ------------------NLAGPEG---------------------KRPRTAYTRYQTLELEKEF 171

  Fly   521 HFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKK 558
            ||||||||.||||||:||.|:|.|:||||||||||.||
Zfish   172 HFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 39/51 (76%)
hoxa5aNP_571615.1 Homeobox 155..208 CDD:278475 39/52 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.