DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and gsx2

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001020683.1 Gene:gsx2 / 561076 ZFINID:ZDB-GENE-041001-114 Length:242 Species:Danio rerio


Alignment Length:115 Identity:48/115 - (41%)
Similarity:58/115 - (50%) Gaps:31/115 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 SLSSNTNN---SG---RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRR 553
            ||.::.|:   :|   ||.||:.||.|||:||..|.||:|.||||||..|.|:|.||||||||||
Zfish   128 SLGASDNSHIQNGKRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRR 192

  Fly   554 MKQKKRVK-------------------------EGLIPADILTQHSTSVI 578
            :|.||..|                         |.|.|.....:..||.|
Zfish   193 VKHKKEGKGTQRSAHAGCKCSGSHSHYPRSEDEESLSPVSATEEKETSPI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 35/51 (69%)
gsx2NP_001020683.1 COG5576 <132..242 CDD:227863 45/109 (41%)
Homeobox 144..196 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.