DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and nkx3.3

DIOPT Version :10

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001013342.2 Gene:nkx3.3 / 503746 ZFINID:ZDB-GENE-050306-27 Length:240 Species:Danio rerio


Alignment Length:89 Identity:38/89 - (42%)
Similarity:55/89 - (61%) Gaps:8/89 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   493 SCSL-SSNTNNS---GRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRR 553
            |||. .||..:|   .|..|::.|:.|||:.|:..|||:...|.::|..|:|.||||||||||||
Zfish    99 SCSFEDSNPKSSKKRSRAAFSHAQVYELERRFNLQRYLSGPERADLAGALKLTETQVKIWFQNRR 163

  Fly   554 MKQKKRVKEGLIPADILTQHSTSV 577
            .|.|:|    .:.|::.|..:|::
Zfish   164 YKTKRR----QMAAELATTPTTTL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeodomain 505..558 CDD:459649 27/52 (52%)
nkx3.3NP_001013342.2 Homeodomain 112..168 CDD:459649 27/55 (49%)

Return to query results.
Submit another query.