DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxa7

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001102703.2 Gene:Hoxa7 / 500126 RGDID:1587253 Length:229 Species:Rattus norvegicus


Alignment Length:198 Identity:66/198 - (33%)
Similarity:86/198 - (43%) Gaps:54/198 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 SGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGV---------------GLG 486
            ||.|.| .|...:..||:..|    ||.:..|..|::     .|:|.               ||.
  Rat    38 SGYGPG-AGAFASNVPGLYNV----NSPLYQNPFASS-----YGLGADAYNLPCASYDQNIPGLC 92

  Fly   487 SGSGLSSCS----------------------LSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRA 529
            |.....:|.                      .|......||..:|..|..||||||||||||||.
  Rat    93 SDLAKGACDKADEGVLHGPAEASFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRR 157

  Fly   530 RRIEIANTLQLNETQVKIWFQNRRMKQKKRVKE-----GLIPADILTQHSTSVISEKPPQQQQPQ 589
            ||||||:.|.|.|.|:||||||||||.||..|:     ..:|.|.:.  |.|..::|..::::.:
  Rat   158 RRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDESQAPTAVPEDAVP--SVSTAADKADEEEEEE 220

  Fly   590 PPE 592
            ..|
  Rat   221 EEE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 37/51 (73%)
Hoxa7NP_001102703.2 Homeobox 133..185 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.